Pfam domain
Pfam family: RS4NT (PF08071.11)
Uniprot AC: P62701
RecName: 40S ribosomal protein S4, X isoform
Begin-End: 3-39
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLR
Structures of the domain P62701 3-39
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 E 3-39 None
5oa3 X-ray 4.3 E 5-41 None


© NPIDB team 2003 - 2020

text