Pfam domain
Pfam family: Ribosomal_S4e (PF00900.19)
Uniprot AC: P62701
RecName: 40S ribosomal protein S4, X isoform
Begin-End: 95-169
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLI
KVNDTIQIDLETGKI
Structures of the domain P62701 95-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 E 95-169 None
5oa3 X-ray 4.3 E 95-169 None


© NPIDB team 2003 - 2020

text