Pfam domain
Pfam family: Ribosomal_S6e (PF01092.18)
Uniprot AC: P62753
RecName: 40S ribosomal protein S6
Begin-End: 1-126
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD
IPGLTD
Structures of the domain P62753 1-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 G 2-127 None
5flx X-ray 3.9 G 2-127 None
5oa3 X-ray 4.3 G 2-127 None


© NPIDB team 2003 - 2020

text