Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62799
RecName: Histone H4
Begin-End: 18-99
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb 

Sequence:
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLY
Structures of the domain P62799 18-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 F 20-98 None
4wu9 X-ray 2.6 F 20-98 None
3kwq X-ray 3.5 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3mgr X-ray 2.3 F 20-98 None
6g0l X-ray 10 B 25-98 None
6g0l X-ray 10 F 17-98 None
5o9g X-ray 4.8 B 20-98 None
6ryr X-ray 3.1 B 20-98 None
3mgq X-ray 2.65 F 20-98 None
2f8n X-ray 2.9 F 225-298  H-Bb S-Bb L-Bb 
6fq6 X-ray 4 F 25-98 None
6fq6 X-ray 4 B 25-98 None
6jyl X-ray 3.37 B 18-98  H-Bb S-Bb L-Bb 
5onw X-ray 2.8 F 23-98 None
3uta X-ray 2.07 F 20-98 None
5oy7 X-ray 5.77 R 25-98 None
5oy7 X-ray 5.77 J 25-98 None
5oy7 X-ray 5.77 B 25-98 None
5oy7 X-ray 5.77 Z 25-98 None
5dnm X-ray 2.81 F 20-98 None
5dnn X-ray 2.8 F 20-98 None
6pww X-ray 4.4 H 25-98  H-Bb S-Bb L-Bb 
6pww X-ray 4.4 L 25-98  H-Bb S-Bb L-Bb 
6kw4 X-ray 7.55 R 19-98  H-Bb H-Mj S-Bb L-Bb 
6kw4 X-ray 7.55 B 25-98  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5nl0 X-ray 5.4 L 25-98 None
5nl0 X-ray 5.4 F 25-98 None
5nl0 X-ray 5.4 B 25-98 None
3kxb X-ray 3.2 F 23-98  H-Bb H-Mj 
3kuy X-ray 2.9 F 20-98 None
6ftx X-ray 4.5 F 17-98 None
6ftx X-ray 4.5 B 25-98 None
3c1c X-ray 3.15 F 225-298  H-Bb H-Mj S-Bb L-Bb 
4j8v X-ray 2.58 F 20-98 None
4j8v X-ray 2.58 F 20-98 None
4j8x X-ray 2.87 F 20-98 None
4j8x X-ray 2.87 F 20-98 None
7crp X-ray 3.2 F 23-98  H-Bb S-Bb L-Bb 
7crp X-ray 3.2 B 25-98  H-Bb S-Bb 
5z3u X-ray 4.31 F 23-98  H-Bb S-Bb L-Bb 
5z3u X-ray 4.31 B 19-98  H-Bb S-Bb L-Bb 
3lel X-ray 2.95 F 23-98 None
3lel X-ray 2.95 P 20-98 None
1m1a X-ray 2.65 F 217-298  H-Bb S-Bb L-Bb 
2nzd X-ray 2.65 F 20-98 None
5e5a X-ray 2.81 F 23-98  H-Bb H-Mj S-Bb L-Bb 
1aoi X-ray 2.8 F 20-98  H-Bb S-Bb L-Bb 
1aoi X-ray 2.8 B 25-98  H-Bb S-Bb L-Bb 
3b6f X-ray 3.45 F 20-98 None
3b6g X-ray 3.45 F 20-98 None
3o62 X-ray 3.22 F 24-98  H-Bb H-Mj S-Bb L-Bb 
3rei X-ray 2.65 F 20-98 None
6ne3 X-ray 3.9 F 25-98  H-Bb S-Bb L-Bb 
6ne3 X-ray 3.9 B 19-98  H-Bb L-Bb 
5mlu X-ray 2.8 B 25-98 None
6k1p X-ray 3.87 B 18-98  H-Bb S-Bb L-Bb 
6k1p X-ray 3.87 F 23-98  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 F 219-298  H-Bb H-Mj S-Bb S-Mn L-Bb 
1m19 X-ray 2.3 F 223-298  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 F 18-98  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 B 18-98  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 F 18-98  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 B 18-98  H-Bb S-Bb L-Bb 
3reh X-ray 2.5 F 20-98 None
3mvd X-ray 2.9 F 23-98  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 B 25-98  H-Bb S-Bb L-Bb 
6jm9 X-ray 7.3 F 20-98 None
3utb X-ray 2.2 B 25-98 None
3lz0 X-ray 2.5 B 25-98 None
6ugm X-ray 3.7 F 23-98  H-Bb S-Bb L-Bb 
6ugm X-ray 3.7 B 25-98  H-Bb S-Bb L-Bb 
3mgp X-ray 2.44 F 20-98 None
3rej X-ray 2.55 B 25-98 None
3rek X-ray 2.6 B 25-98 None
3rel X-ray 2.7 B 25-98 None
3lz1 X-ray 2.5 B 25-98 None
4ld9 X-ray 3.31 F 24-98 None
4ld9 X-ray 3.31 B 21-98 None
3ut9 X-ray 2.2 F 20-98 None
6esi X-ray 6.3 F 25-98 None
1m18 X-ray 2.45 F 225-298  H-Bb H-Mj S-Bb L-Bb 
4kgc X-ray 2.69 F 20-98 None
6fq8 X-ray 4.8 F 25-98 None
6fq8 X-ray 4.8 B 23-98 None
6ryu X-ray 4 B 20-98 None
6ryu X-ray 4 F 20-98 None
4r8p X-ray 3.28 B 23-98 None
3c1b X-ray 2.2 F 223-298  H-Bb H-Mj S-Bb L-Bb 
3lja X-ray 2.75 F 20-98 None
1zbb X-ray 9 f 17-98  H-Bb H-Mj S-Bb L-Bb L-Mj 
1zbb X-ray 9 F 17-98  H-Bb H-Mj S-Bb L-Bb 
4xuj X-ray 3.18 F 20-98 None
6fq5 X-ray 3.8 F 24-98 None
6fq5 X-ray 3.8 B 24-98 None
6pa7 X-ray 2.94 F 25-98  H-Bb H-Mj S-Bb L-Bb 
6o96 X-ray 3.5 F 24-98  H-Bb S-Bb L-Bb 
6o96 X-ray 3.5 B 24-98  H-Bb S-Bb L-Bb 
5f99 X-ray 2.63 F 17-98 None
5f99 X-ray 2.63 B 25-98 None
6kw3 X-ray 7.13 B 25-98  H-Bb H-Mj S-Bb L-Bb 
6kw3 X-ray 7.13 R 19-98  H-Bb H-Mj S-Bb L-Bb 
5z3o X-ray 3.62 F 23-98  H-Bb S-Bb L-Bb 
5z3o X-ray 3.62 B 19-98  H-Bb S-Bb L-Bb 
5cp6 X-ray 2.6 F 20-98 None
5omx X-ray 2.32 F 23-98 None
5ong X-ray 2.8 F 25-98 None
6r1t X-ray 3.7 F 23-98 None
6r1t X-ray 3.7 B 20-98 None
6iy3 X-ray 3.67 F 19-98  H-Bb S-Bb L-Bb 
6iy3 X-ray 3.67 B 25-98  H-Bb L-Bb 
5xf6 X-ray 2.63 F 20-98 None
6iro X-ray 3.4 B 19-98  H-Bb S-Bb L-Bb 
6iro X-ray 3.4 F 23-98  H-Bb L-Bb 
6pwv X-ray 6.2 L 25-98  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 H 25-98  H-Bb S-Bb L-Bb 
4zux X-ray 3.82 L 25-98 None
4zux X-ray 3.82 B 12-85 None
6iy2 X-ray 3.47 B 19-98  H-Bb L-Bb 
6uxw X-ray 8.96 S 25-98  H-Bb S-Bb L-Bb 
6i84 X-ray 4.4 O 25-98  L-Bb 
5oxv X-ray 6.72 B 25-98 None
5oxv X-ray 6.72 L 25-98 None
1zla X-ray 2.9 F 225-298  H-Bb H-Mj S-Bb L-Bb 
6uh5 X-ray 3.5 F 23-98  H-Bb S-Bb L-Bb 
6uh5 X-ray 3.5 B 25-98  H-Bb S-Bb L-Bb 
3mnn X-ray 2.5 F 20-98 None
6esf X-ray 3.7 F 24-98 None
6esf X-ray 3.7 B 24-98 None
6r1u X-ray 4.36 B 23-98 None
6kiz X-ray 4.5 B 25-98  L-Bb 
3mgs X-ray 3.15 F 20-98 None
6t9l X-ray 3.6 B 25-98 None
6pwx X-ray 4.2 L 25-98  H-Bb S-Bb L-Bb 
6pwx X-ray 4.2 H 25-98  H-Bb H-Mj S-Bb L-Bb 
1kx3 X-ray 2 F 20-98 None
1kx3 X-ray 2 B 25-98 None
1kx4 X-ray 2.6 B 25-98 None
1kx5 X-ray 1.94 F 17-98 None
1kx5 X-ray 1.94 B 17-98 None
1p34 X-ray 2.7 B 25-98  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 F 224-298  H-Bb H-Mj S-Bb L-Bb 
1p3l X-ray 2.4 F 225-298  H-Bb H-Mj S-Bb S-Mn L-Bb 
4j8u X-ray 2.38 F 20-98 None
6kw5 X-ray 10.13 S 25-98  H-Bb L-Bb 
6kw5 X-ray 10.13 W 19-98  H-Bb S-Bb 
6tda X-ray 15 B 19-98  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 F 24-98  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 B 24-98  S-Bb L-Bb L-Mj 
6om3 X-ray 3.3 N 24-98  H-Bb H-Mj S-Bb L-Bb 
6nqa X-ray 3.54 F 19-98  H-Bb L-Bb 
4j8w X-ray 2.41 F 20-98 None
5kgf X-ray 4.54 F 25-98 None
5kgf X-ray 4.54 B 25-98 None
5x0y X-ray 4.69 F 23-98  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 B 19-98  H-Bb S-Bb L-Bb 
6j99 X-ray 4.1 B 20-98  H-Bb S-Bb L-Bb 
6s01 X-ray 3.2 F 23-98 None
6s01 X-ray 3.2 B 25-98 None
5x0x X-ray 3.97 F 23-98  H-Bb S-Bb L-Bb 
5x0x X-ray 3.97 B 25-98  H-Bb S-Bb L-Bb 
6kiw X-ray 4 B 25-98  H-Bb L-Bb 
5z3v X-ray 4.22 F 19-98  H-Bb S-Bb L-Bb 
5z3v X-ray 4.22 B 25-98  H-Bb S-Bb L-Bb 
6jma X-ray 6.8 F 20-98 None
6kiv X-ray 4 B 20-98  H-Bb L-Bb 
5z3l X-ray 4.31 F 23-98  H-Bb H-Mj S-Bb L-Bb 
5z3l X-ray 4.31 B 19-98  H-Bb H-Mj L-Bb 
7crr X-ray 3.48 B 25-98  H-Bb S-Bb 
7crr X-ray 3.48 F 23-98  H-Bb S-Bb L-Bb 
6vz4 X-ray 3.9 B 20-99  H-Bb S-Bb L-Bb 
7crq X-ray 3.15 B 25-98  H-Bb L-Bb 
7crq X-ray 3.15 F 23-98  H-Bb S-Bb 
7cro X-ray 3.75 B 25-98  S-Bb 
7cro X-ray 3.75 F 23-98  H-Bb L-Bb 
6nj9 X-ray 2.96 B 19-98  H-Bb L-Bb 
6nj9 X-ray 2.96 F 19-98  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text