Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P62799
RecName: Histone H4
Begin-End: 26-99
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM
DVVYALKRQGRTLY
Structures of the domain P62799 26-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p3f X-ray 2.9 F 246-295  S-Bb L-Bb 
1p3f X-ray 2.9 B 46-95  S-Bb L-Bb 
3kwq X-ray 3.5 B 35-95  H-Bb S-Bb L-Bb 
3mgr X-ray 2.3 B 35-95 None
1p3i X-ray 2.3 F 239-295  S-Bb L-Bb 
1p3i X-ray 2.3 B 39-95  S-Bb L-Bb 
1kx4 X-ray 2.6 F 35-95 None
4j8v X-ray 2.58 B 35-95 None
4j8v X-ray 2.58 B 35-95 None
3c1c X-ray 3.15 B 35-95  H-Bb S-Bb L-Bb 
3c1b X-ray 2.2 B 34-95  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 F 235-295  H-Bb S-Bb L-Bb 
3uta X-ray 2.07 B 35-95 None
3utb X-ray 2.2 F 35-95 None
5omx X-ray 2.32 B 35-95 None
1p3g X-ray 2.7 B 39-95  S-Bb L-Bb 
4j8x X-ray 2.87 B 35-95 None
4j8x X-ray 2.87 B 35-95 None
1p3a X-ray 3 F 235-295  H-Bb S-Bb L-Bb 
1p3a X-ray 3 B 35-95  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 F 233-295  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 B 33-95  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 F 235-295  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 B 35-95  H-Bb S-Bb L-Bb 
6esi X-ray 6.3 B 35-95 None
3kxb X-ray 3.2 B 40-95 None
3kuy X-ray 2.9 B 35-95 None
1p3p X-ray 2.7 B 37-95  S-Bb L-Bb 
1p3p X-ray 2.7 F 237-295  S-Bb L-Bb 
3b6f X-ray 3.45 B 35-95 None
1p3b X-ray 3 F 241-295  S-Bb L-Bb 
1p3b X-ray 3 B 41-95  S-Bb L-Bb 
3lel X-ray 2.95 B 35-95 None
3lel X-ray 2.95 L 35-95 None
1p3k X-ray 2.9 F 235-295  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 B 35-95  H-Bb S-Bb L-Bb 
2f8n X-ray 2.9 B 35-95  H-Bb S-Bb L-Bb 
1m1a X-ray 2.65 B 34-95  H-Bb S-Bb L-Bb 
3b6g X-ray 3.45 B 35-95 None
2nzd X-ray 2.65 B 35-95 None
4xzq X-ray 2.4 F 235-295  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 B 35-95  H-Bb S-Bb L-Bb 
4wu9 X-ray 2.6 B 35-95 None
1p3l X-ray 2.4 B 35-95  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 B 35-95  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 F 235-295  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 B 34-95  H-Bb S-Bb L-Bb 
4kgc X-ray 2.69 B 35-95 None
1s32 X-ray 2.05 B 35-95  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 B 35-95  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 B 35-95  H-Bb S-Bb L-Bb 
3rek X-ray 2.6 F 35-95 None
5mlu X-ray 2.8 F 35-95 None
3reh X-ray 2.5 B 35-95 None
3rel X-ray 2.7 F 35-95 None
3rej X-ray 2.55 F 35-95 None
1zla X-ray 2.9 B 35-95  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 B 35-95 None
3lz0 X-ray 2.5 F 35-95 None
3ut9 X-ray 2.2 B 35-95 None
5ong X-ray 2.8 B 35-95 None
3lz1 X-ray 2.5 F 35-95 None
1m18 X-ray 2.45 B 35-95  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 B 35-95 None
4j8u X-ray 2.38 B 35-95 None
3lja X-ray 2.75 B 35-95 None
4r8p X-ray 3.28 F 35-95 None
5onw X-ray 2.8 B 35-95 None
5e5a X-ray 2.81 B 35-95  H-Bb S-Bb L-Bb 
5xf6 X-ray 2.63 B 35-95 None
4wu8 X-ray 2.45 B 35-95 None
3mgq X-ray 2.65 B 35-95 None
4zux X-ray 3.82 F 35-95 None
4zux X-ray 3.82 P 35-95 None
5dnm X-ray 2.81 B 35-95 None
3mgp X-ray 2.44 B 35-95 None
3mnn X-ray 2.5 B 35-95 None
4xuj X-ray 3.18 B 35-95 None
6esh X-ray 5.1 F 34-95 None
6esh X-ray 5.1 B 35-95 None
5o9g X-ray 4.8 F 35-95 None
4j8w X-ray 2.41 B 35-95 None
4j8w X-ray 2.41 B 35-95 None
4z66 X-ray 2.5 F 235-295  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 B 35-95  H-Bb S-Bb L-Bb 
3mgs X-ray 3.15 B 35-95 None
5dnn X-ray 2.8 B 35-95 None
5cp6 X-ray 2.6 B 35-95 None
6esg X-ray 5.4 F 35-95 None
6esg X-ray 5.4 B 35-95 None


© NPIDB team 2003 - 2019

text