Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P62801
RecName: Histone H4
Begin-End: 18-99
Organism: Gallus gallus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLY
Structures of the domain P62801 18-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eqz X-ray 2.5 H 33-95  H-Bb S-Bb L-Bb 
1eqz X-ray 2.5 D 33-95  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text