Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62805
RecName: Histone H4
Begin-End: 26-99
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM
DVVYALKRQGRTLY
Structures of the domain P62805 26-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6se0 X-ray 3.8 F 26-98 None
6se0 X-ray 3.8 B 26-98 None
5x7x X-ray 2.18 B 26-98  H-Bb S-Bb S-Mn L-Bb 
3w98 X-ray 3.42 B 26-98  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 B 26-98  H-Bb S-Bb L-Bb 
6j4y X-ray 4.3 f 26-98 None
6j4y X-ray 4.3 b 12-88 None
5xf4 X-ray 2.87 B 25-98 None
2cv5 X-ray 2.5 B 26-98  H-Bb S-Bb L-Bb 
5cpk X-ray 2.63 B 26-98  H-Bb S-Bb L-Bb 
5z23 X-ray 2.73 B 26-98  H-Bb S-Bb L-Bb 
5av9 X-ray 2.2 B 25-98 None
6a5r X-ray 8.7 f 26-98 None
6a5r X-ray 8.7 b 26-98 None
6t7b X-ray 5.1 F 25-98  L-Bb 
3x1s X-ray 2.81 B 26-98  H-Bb S-Bb L-Bb 
3x1t X-ray 2.81 B 25-98  H-Bb S-Bb L-Bb 
3x1v X-ray 2.92 B 26-98  H-Bb S-Bb L-Bb 
6r8y X-ray 4.3 F 26-99  H-Bb S-Bb L-Bb 
6l9h X-ray 2.6 F 26-98 None
6se6 X-ray 3.5 B 25-98 None
6y5d X-ray 4.1 R 27-99  H-Bb S-Bb L-Bb 
6y5d X-ray 4.1 N 27-99  H-Bb L-Bb 
6y5d X-ray 4.1 B 26-99  H-Bb S-Bb L-Bb 
6hts X-ray 4.8 J 25-98 None
6upl X-ray 7.4 B 26-98 None
6j4z X-ray 4.1 f 26-98 None
6j4z X-ray 4.1 b 26-98 None
6t93 X-ray 3.49 F 26-99  H-Bb S-Bb L-Bb 
6t93 X-ray 3.49 B 26-99  H-Bb S-Bb L-Bb 
6upk X-ray 4.9 B 26-98 None
6upk X-ray 4.9 F 26-98 None
7joa X-ray 3.3 B 25-98 None
6see X-ray 4.2 F 26-98 None
6see X-ray 4.2 B 26-98 None
6jr1 X-ray 2.4 B 26-98  H-Bb S-Bb L-Bb L-Mn 
3wtp X-ray 2.67 B 26-98  H-Bb S-Bb L-Bb 
6k1k X-ray 2.2 F 25-98 None
3azg X-ray 2.4 B 26-98  H-Bb S-Bb L-Bb 
7jo9 X-ray 3.3 B 25-98 None
6sef X-ray 3.7 F 26-98 None
6sef X-ray 3.7 B 26-98 None
3waa X-ray 3.2 B 26-98  H-Bb S-Bb L-Bb 
6buz X-ray 3.92 F 27-99 None
6buz X-ray 3.92 B 27-99 None
6e0p X-ray 2.6 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6e0p X-ray 2.6 F 26-98  H-Bb S-Bb L-Bb 
3afa X-ray 2.5 B 26-98  H-Bb S-Bb L-Bb 
3av1 X-ray 2.5 B 26-98  H-Bb S-Bb L-Bb 
3azi X-ray 2.7 B 27-98  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 B 26-98  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 B 26-98  H-Bb S-Bb L-Bb 
3aze X-ray 3 B 26-98  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 B 26-98  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 B 26-98  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 B 26-98  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
3azn X-ray 3 B 26-98  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 B 25-98  H-Bb S-Bb L-Bb 
3an2 X-ray 3.6 F 26-98 None
3an2 X-ray 3.6 B 26-98 None
3azh X-ray 3.49 B 26-98  H-Bb S-Bb L-Bb 
6kvd X-ray 2.21 B 26-98  H-Bb S-Bb L-Bb 
6ke9 X-ray 2.22 F 26-98 None
5cpi X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 F 26-98  H-Bb S-Bb L-Bb 
6j4w X-ray 7.9 b 12-88 None
6j4w X-ray 7.9 f 26-98 None
4ym6 X-ray 3.51 B 26-98  H-Bb S-Bb L-Bb 
3wa9 X-ray 3.07 B 26-98  H-Bb S-Bb L-Bb 
3w96 X-ray 3 B 27-98  H-Bb 
6hkt X-ray 9.7 P 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 z 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 v 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 Z 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 V 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 p 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 l 25-98  H-Bb S-Bb S-Mn L-Bb 
6hkt X-ray 9.7 L 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 f 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 b 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 F 25-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 B 25-98  H-Bb S-Bb L-Bb 
3w97 X-ray 3.2 B 26-98  H-Bb S-Bb L-Bb 
5xf3 X-ray 2.6 B 25-98 None
5b0y X-ray 2.56 B 26-98  H-Bb S-Bb L-Bb 
5av6 X-ray 2.2 B 25-98 None
6jr0 X-ray 2.5 B 26-98  H-Bb S-Bb L-Bb L-Mn 
6k1j X-ray 2.85 B 25-98 None
5gse X-ray 3.14 F 26-98  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 P 25-98  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 B 25-98  H-Bb S-Bb L-Bb 
5gtc X-ray 2.7 B 26-98  H-Bb S-Bb L-Bb 
6ipu X-ray 1.99 B 25-98 None
5b33 X-ray 2.93 B 26-98  H-Bb S-Bb L-Bb 
6xjd X-ray 6.8 B 26-98  H-Bb H-Mj L-Bb 
6xjd X-ray 6.8 F 25-98  H-Bb L-Bb 
5gt3 X-ray 2.91 B 25-98  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 B 26-98  H-Bb S-Bb L-Bb 
5av8 X-ray 2.2 B 25-98 None
5avb X-ray 2.4 B 25-98 None
5b2i X-ray 3 B 25-98 None
5b32 X-ray 2.35 B 26-98  H-Bb S-Bb L-Bb 
5gt0 X-ray 2.82 B 26-98  H-Bb H-Mj S-Bb L-Bb 
5y0d X-ray 1.99 B 26-98  H-Bb S-Bb S-Mn L-Bb 
5avc X-ray 2.4 B 25-98 None
5xf5 X-ray 2.82 B 25-98 None
6e0c X-ray 2.63 F 26-98  H-Bb S-Bb L-Bb 
6e0c X-ray 2.63 B 26-98  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 B 26-98  H-Bb S-Bb L-Bb 
5b31 X-ray 2.2 B 26-98  H-Bb S-Bb L-Bb 
6fml X-ray 4.34 R 25-98 None
6fml X-ray 4.34 N 26-98 None
6m3v X-ray 4.6 P 26-98  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 L 26-98  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 F 26-98  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 B 26-98  H-Bb S-Bb L-Bb 
5jrg X-ray 2.5 B 26-98  H-Bb S-Bb L-Bb 
3w99 X-ray 3 B 26-98  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 B 26-98  H-Bb S-Bb L-Bb 
5av5 X-ray 2.4 B 25-98 None
6yov X-ray 3.42 F 26-99  H-Bb S-Bb L-Bb 
6yov X-ray 3.42 B 26-99  H-Bb S-Bb L-Bb 
5y0c X-ray 2.09 B 26-98  H-Bb S-Bb L-Bb 
6kxv X-ray 3.63 B 26-98  H-Bb S-Bb L-Bb 
6l49 X-ray 18.9 P 26-98 None
6l49 X-ray 18.9 X 26-98 None
6l49 X-ray 18.9 F 26-98 None
6l49 X-ray 18.9 B 26-98 None
5z30 X-ray 2.45 B 26-98  H-Bb S-Bb L-Bb 
5zbx X-ray 2.58 B 26-98  H-Bb S-Bb L-Bb 
5b2j X-ray 2.6 B 25-98 None
6inq X-ray 6.9 f 26-98 None
6inq X-ray 6.9 b 26-98 None
6a5o X-ray 9.9 f 72-144 None
6a5o X-ray 9.9 b 12-84 None
6a5u X-ray 7.6 b 12-84 None
6a5u X-ray 7.6 f 72-144 None
6iq4 X-ray 2.25 B 25-98 None
6a5p X-ray 7 b 12-84 None
6a5p X-ray 7 f 72-144 None
6j4x X-ray 4.3 f 26-98 None
6j4x X-ray 4.3 b 26-98 None
6j51 X-ray 4.2 b 26-98 None
6j51 X-ray 4.2 f 26-98 None
5cpj X-ray 3.15 B 26-98  H-Bb 
6a5l X-ray 5.6 f 72-144 None
6a5l X-ray 5.6 b 12-84 None
5gsu X-ray 3.1 B 26-98  H-Bb S-Bb L-Bb 
6le9 X-ray 2.6 F 26-98 None
6k1i X-ray 2.75 B 26-98 None
7ccr X-ray 4.9 F 26-98 None
7ccr X-ray 4.9 B 26-98 None
7ccr X-ray 4.9 Q 26-98 None
7ccr X-ray 4.9 M 26-98 None
4ym5 X-ray 4.01 B 26-98  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 B 26-98  H-Bb S-Bb L-Bb 
6j50 X-ray 4.7 f 72-144 None
6j50 X-ray 4.7 b 12-88 None
6r8z X-ray 3.9 F 26-99  H-Bb S-Bb L-Bb 
6seg X-ray 3.1 F 26-98 None
6seg X-ray 3.1 B 26-98 None
6l4a X-ray 12.3 X 26-98 None
6l4a X-ray 12.3 P 26-98 None
6l4a X-ray 12.3 F 26-98 None
6jxd X-ray 2.25 B 26-98 None
6c0w X-ray 4 F 26-98 None
6c0w X-ray 4 B 26-98 None
6r90 X-ray 4.5 B 27-99  H-Bb S-Bb L-Bb 
6ir9 X-ray 3.8 f 72-144 None
6ir9 X-ray 3.8 b 12-88 None
5b40 X-ray 3.33 F 27-98  H-Bb H-Mj 
5b40 X-ray 3.33 B 28-98  H-Bb 
6a5t X-ray 6.7 f 72-144 None
6a5t X-ray 6.7 b 12-84 None
6v92 X-ray 20 b 26-98  H-Bb S-Bb L-Bb 
6o1d X-ray 3.4 F 26-98  H-Bb S-Bb L-Bb 
6o1d X-ray 3.4 B 26-98  H-Bb S-Bb L-Bb 
6r93 X-ray 4 F 26-99  H-Bb S-Bb L-Bb 
6r93 X-ray 4 B 26-99  H-Bb S-Bb L-Bb 
6muo X-ray 3.6 F 25-98 None
5ay8 X-ray 2.8 F 26-98  H-Bb H-Mj S-Bb L-Bb 
5ay8 X-ray 2.8 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6t90 X-ray 3.05 F 26-99  H-Bb S-Bb L-Bb 
6t90 X-ray 3.05 B 26-99  H-Bb S-Bb L-Bb 
6r92 X-ray 4.8 F 26-99  H-Bb S-Bb L-Bb 
6r92 X-ray 4.8 B 26-99  H-Bb H-Mj S-Bb L-Bb 
6r91 X-ray 4.1 F 26-99  H-Bb H-Mj S-Bb L-Bb 
6r91 X-ray 4.1 B 26-99  H-Bb S-Bb L-Bb L-Mn 
6r0c X-ray 4.2 F 26-98 None
6m4h X-ray 3.9 B 26-98  H-Bb S-Bb L-Bb 
6m4h X-ray 3.9 F 26-98  H-Bb S-Bb L-Bb 
6y5e X-ray 3.15 B 26-99  H-Bb S-Bb L-Bb 
7ccq X-ray 3.8 F 26-98 None
7ccq X-ray 3.8 B 26-98 None
6x59 X-ray 2.98 F 25-98  H-Bb S-Bb L-Bb 
6x59 X-ray 2.98 B 26-98  H-Bb S-Bb L-Bb 
6x5a X-ray 4.36 F 25-98  H-Bb S-Bb L-Bb 
6x5a X-ray 4.36 B 26-98  H-Bb S-Bb L-Bb 
7a08 X-ray 3.11 i 26-98 None
7a08 X-ray 3.11 e 26-98 None
6m4g X-ray 2.8 F 26-98  H-Bb S-Bb 
6m4g X-ray 2.8 B 26-98  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 P 26-98  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 L 26-98  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 F 25-98  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 B 25-98  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 L 26-98  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 F 25-98  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 B 26-98  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 P 26-98  H-Bb S-Bb L-Bb 
6m4d X-ray 4.4 F 26-98  H-Bb H-Mj S-Bb L-Bb 
6m4d X-ray 4.4 B 26-98  H-Bb H-Mj L-Bb 
6jou X-ray 2.17 B 26-98  H-Bb S-Bb L-Bb 
6usj X-ray 10.5 B 26-98 None
6usj X-ray 10.5 L 26-98 None
6m44 X-ray 3.81 B 26-98  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 F 26-98  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 L 26-98  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 P 26-98  H-Bb S-Bb L-Bb 
6v2k X-ray 2.6 B 26-98  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 F 26-98  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 f 26-98  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text