Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P62805
RecName: Histone H4
Begin-End: 26-99
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM
DVVYALKRQGRTLY
Structures of the domain P62805 26-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xf4 X-ray 2.87 B 35-95 None
5x7x X-ray 2.18 B 35-95  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 B 35-95  H-Bb S-Bb L-Bb 
2cv5 X-ray 2.5 B 35-95  H-Bb S-Bb L-Bb 
5av9 X-ray 2.2 B 35-95 None
5b40 X-ray 3.33 F 41-95 None
5b40 X-ray 3.33 B 41-95 None
5ay8 X-ray 2.8 F 35-95  H-Bb S-Bb L-Bb 
5ay8 X-ray 2.8 B 35-95  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 B 35-95  H-Bb S-Bb L-Bb 
3w98 X-ray 3.42 B 35-95  H-Bb S-Bb L-Bb 
3waa X-ray 3.2 B 35-95  H-Bb S-Bb L-Bb 
3afa X-ray 2.5 B 35-95  H-Bb S-Bb L-Bb 
3av1 X-ray 2.5 B 35-95  H-Bb S-Bb L-Bb 
3azi X-ray 2.7 B 40-95  S-Bb L-Bb 
3av2 X-ray 2.8 B 35-95  H-Bb S-Bb L-Bb 
3azf X-ray 2.7 B 35-95  H-Bb S-Bb L-Bb 
3aze X-ray 3 B 35-95  S-Bb L-Bb 
3azj X-ray 2.89 B 35-95  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 B 35-95  H-Bb S-Bb L-Bb 
3azm X-ray 2.89 B 35-95  S-Bb L-Bb 
3ayw X-ray 2.9 B 35-95  H-Bb S-Bb L-Bb 
3azn X-ray 3 B 35-95  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 B 35-95  H-Bb S-Bb L-Bb 
3an2 X-ray 3.6 F 35-95 None
3an2 X-ray 3.6 B 35-95 None
3azh X-ray 3.49 B 35-95  H-Bb S-Bb L-Bb 
3wa9 X-ray 3.07 B 35-95  H-Bb S-Bb L-Bb 
3w96 X-ray 3 B 37-95 None
3w97 X-ray 3.2 B 35-95  S-Bb L-Bb 
5xf3 X-ray 2.6 B 35-95 None
3wtp X-ray 2.67 B 35-95  H-Bb S-Bb L-Bb 
5av6 X-ray 2.2 B 35-95 None
5cpi X-ray 2.9 B 35-95  S-Bb 
3wkj X-ray 2.8 B 35-95  H-Bb S-Bb L-Bb 
6c0w X-ray 4 F 35-95 None
6c0w X-ray 4 B 34-95 None
3x1t X-ray 2.81 B 35-95  H-Bb S-Bb L-Bb 
3x1s X-ray 2.81 B 35-95  H-Bb S-Bb L-Bb 
5b33 X-ray 2.93 B 35-95  H-Bb S-Bb L-Bb 
5cpk X-ray 2.63 B 35-95 None
5gt3 X-ray 2.91 B 35-95  H-Bb S-Bb L-Bb 
4ym6 X-ray 3.51 B 35-95  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 B 35-95  H-Bb S-Bb L-Bb 
5b2j X-ray 2.6 B 35-95 None
5gxq X-ray 2.85 B 35-95  H-Bb S-Bb L-Bb 
4ym5 X-ray 4.01 B 35-95  H-Bb S-Bb L-Bb 
5av8 X-ray 2.2 B 35-95 None
5gtc X-ray 2.7 B 35-95  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 B 35-95  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 F 35-95  H-Bb S-Bb L-Bb 
5gt0 X-ray 2.82 B 35-95  H-Bb S-Bb L-Bb 
5av5 X-ray 2.4 B 35-95 None
5gsu X-ray 3.1 B 35-95  H-Bb S-Bb L-Bb 
5b2i X-ray 3 B 35-95 None
5gse X-ray 3.14 P 35-95  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 F 34-95  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 B 35-95  H-Bb S-Bb L-Bb 
5b0y X-ray 2.56 B 35-95  H-Bb S-Bb L-Bb 
5cpj X-ray 3.15 B 35-95 None
5avb X-ray 2.4 B 35-95 None
6etx X-ray 4.8 J 35-95 None
5avc X-ray 2.4 B 35-95 None
5b32 X-ray 2.35 B 35-95  H-Bb S-Bb L-Bb 
6buz X-ray 3.92 F 35-96 None
6buz X-ray 3.92 B 35-96 None
5xf5 X-ray 2.82 B 35-95 None
3x1v X-ray 2.92 B 35-95  H-Bb S-Bb L-Bb 
6fml X-ray 4.34 R 35-95 None
6fml X-ray 4.34 N 35-95 None
5b31 X-ray 2.2 B 35-95  H-Bb S-Bb L-Bb 
5jrg X-ray 2.5 B 35-95  H-Bb S-Bb L-Bb 
3w99 X-ray 3 B 35-95  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text