Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P62806
RecName: Histone H4
Begin-End: 24-99
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVT
AMDVVYALKRQGRTLY
Structures of the domain P62806 24-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1u35 X-ray 3 F 234-295  H-Bb S-Bb L-Bb 
1u35 X-ray 3 B 35-95  H-Bb S-Bb L-Bb 
1f66 X-ray 2.6 B 34-95  H-Bb S-Bb L-Bb 
5b1m X-ray 2.34 F 34-95  H-Bb S-Bb L-Bb 
5b1m X-ray 2.34 B 35-95  H-Bb S-Bb L-Bb 
5b1l X-ray 2.35 F 34-95  H-Bb S-Bb L-Bb 
5b1l X-ray 2.35 B 35-95  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text