Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P62807
RecName: Histone H2B type 1-C/E/F/G/I
Begin-End: 27-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNK
RSTITSREIQTAVRLL
Structures of the domain P62807 27-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5kgf X-ray 4.54 D 24-97 None


© NPIDB team 2003 - 2019

text