Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P62807
RecName: Histone H2B type 1-C/E/F/G/I
Begin-End: 33-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P62807 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5kgf X-ray 4.54 H 27-97 None
6c0w X-ray 4 D 34-100 None
6c0w X-ray 4 H 34-100 None
5gt0 X-ray 2.82 H 33-100  H-Bb S-Bb L-Bb 
5gt0 X-ray 2.82 D 29-100  H-Bb H-Mj S-Bb L-Bb L-Mn 
6fml X-ray 4.34 T 32-100 None
6fml X-ray 4.34 P 32-100 None


© NPIDB team 2003 - 2019

text