Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: P62841
RecName: 40S ribosomal protein S15
Begin-End: 43-128
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTF
NQVEIKPEMIGHYLGEFSITYKPVKH
Structures of the domain P62841 43-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 P 43-128 None
5flx X-ray 3.9 P 43-128 None
5oa3 X-ray 4.3 P 43-128 None


© NPIDB team 2003 - 2020

text