Pfam domain
Pfam family: Ribosomal_S24e (PF01282.18)
Uniprot AC: P62847
RecName: 40S ribosomal protein S24
Begin-End: 24-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAK
KNEPKHRLARHGLYEKKKT
Structures of the domain P62847 24-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 Y 24-101 None
5flx X-ray 3.9 Y 24-101 None
5oa3 X-ray 4.3 Y 24-101 None


© NPIDB team 2003 - 2020

text