Pfam domain
Pfam family: Ribosomal_S26e (PF01283.18)
Uniprot AC: P62854
RecName: 40S ribosomal protein S26
Begin-End: 2-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDA
YVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFR
Structures of the domain P62854 2-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 a 2-102 None
5flx X-ray 3.9 a 2-98 None
5oa3 X-ray 4.3 a 2-102 None


© NPIDB team 2003 - 2020

text