Pfam domain
Pfam family: HMG_box_2 (PF09011.12)
Uniprot AC: P63158
RecName: High mobility group protein B1
Begin-End: 11-76
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn 

Sequence:
GKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR
YEREMK
Structures of the domain P63158 11-76
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zdz X-ray 2.8 N 11-98  H-Bb H-Mj H-Mn 
5ze0 X-ray 2.75 N 10-97  H-Bb H-Mj H-Mn 
5ze2 X-ray 3.3 N 11-98  H-Bb H-Mj H-Mn 
5ze1 X-ray 3 N 11-98  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text