Pfam domain
Pfam family: HMG_box_2 (PF09011.12)
Uniprot AC: P63159
RecName: High mobility group protein B1
Begin-End: 8-78
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD
KARYEREMKTY
Structures of the domain P63159 8-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ckt X-ray 2.5 A 7-77  H-Bb H-Mj H-Mn L-Bb 
4qr9 X-ray 2 B 5-78  H-Bb H-Mj H-Mn L-Bb 
4qr9 X-ray 2 A 5-78  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text