Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: P63159
RecName: High mobility group protein B1
Begin-End: 95-163
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEK
YEKDIAAYR
Structures of the domain P63159 95-163
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2gzk NMR A 89-157  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2020

text