Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: P63244
RecName: Receptor of activated protein C kinase 1
Begin-End: 224-260
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWD
Structures of the domain P63244 224-260
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 g 225-260 None
5a2q X-ray 3.9 g 188-220 None
5a2q X-ray 3.9 g 146-178 None
5a2q X-ray 3.9 g 97-133 None
5a2q X-ray 3.9 g 55-91 None
5flx X-ray 3.9 g 225-260 None
5flx X-ray 3.9 g 146-178 None
5flx X-ray 3.9 g 188-220 None
5flx X-ray 3.9 g 55-91 None
5flx X-ray 3.9 g 97-133 None
5oa3 X-ray 4.3 g 188-220 None
5oa3 X-ray 4.3 g 225-260 None
5oa3 X-ray 4.3 g 146-178 None
5oa3 X-ray 4.3 g 97-133 None
5oa3 X-ray 4.3 g 55-91 None


© NPIDB team 2003 - 2020

text