Pfam domain
Pfam family: Spt4 (PF06093.12)
Uniprot AC: P63272
RecName: Transcription elongation factor SPT4
Begin-End: 13-90
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVS
KWQRVSNFKPGVYAVSVT
Structures of the domain P63272 13-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oik X-ray 3.7 Y 13-90 None


© NPIDB team 2003 - 2019

text