Pfam domain
Pfam family: Toprim (PF01751.21)
Uniprot AC: P66937
RecName: DNA gyrase subunit B
Begin-End: 430-542
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
EIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGI
GGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQP
Structures of the domain P66937 430-542
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fqm X-ray 3.06 D 449-541 None
6fqm X-ray 3.06 B 447-541 None
6fqm X-ray 3.06 d 448-595 None
6fqm X-ray 3.06 b 451-594 None
5npk X-ray 1.98 B 430-541 None
5npk X-ray 1.98 D 430-541 None
5npk X-ray 1.98 b 430-541 None
5npk X-ray 1.98 d 430-541 None
2xct X-ray 3.35 B 430-541 None
2xct X-ray 3.35 D 430-541 None
2xct X-ray 3.35 U 430-541 None
2xct X-ray 3.35 S 430-541 None
2xcr X-ray 3.5 S 430-541  H-Bb L-Bb L-Mn 
2xcr X-ray 3.5 U 430-541  H-Bb L-Bb L-Mj L-Mn 
2xcr X-ray 3.5 D 430-541 None
2xcr X-ray 3.5 B 430-541 None
2xcs X-ray 2.1 B 430-541  H-Bb L-Bb L-Mn 
2xcs X-ray 2.1 D 430-541  H-Bb L-Bb L-Mn 
5cdp X-ray 2.45 D 430-541 None
5cdp X-ray 2.45 B 430-541 None
5cdn X-ray 2.79 D 430-541 None
5cdn X-ray 2.79 B 430-541 None
5cdn X-ray 2.79 S 430-541 None
5cdn X-ray 2.79 U 430-541 None
5iwm X-ray 2.5 B 430-541  H-Bb L-Bb L-Mn 
5iwm X-ray 2.5 D 430-541  H-Bb L-Bb L-Mn 
5cdq X-ray 2.95 D 430-541 None
5cdq X-ray 2.95 B 430-541 None
5cdq X-ray 2.95 U 430-541 None
5cdq X-ray 2.95 S 430-541 None
5cdr X-ray 2.65 D 430-541 None
5cdr X-ray 2.65 B 430-541 None
5iwi X-ray 1.98 B 430-541  H-Bb L-Bb L-Mn 
5iwi X-ray 1.98 D 430-541  H-Bb L-Bb L-Mn 
5cdo X-ray 3.15 D 430-541 None
5cdo X-ray 3.15 B 430-541 None
5cdo X-ray 3.15 U 430-541 None
5cdo X-ray 3.15 S 430-541 None
5cdm X-ray 2.5 B 430-541 None
5cdm X-ray 2.5 D 430-541 None
4bul X-ray 2.6 A 430-541  H-Bb L-Bb L-Mn 
4bul X-ray 2.6 C 430-541  H-Bb L-Bb L-Mn 
5npp X-ray 2.22 D 430-541 None
5npp X-ray 2.22 B 430-541 None
6fqs X-ray 3.11 D 430-541 None
6fqs X-ray 3.11 B 430-541 None
6fqv X-ray 2.6 D 430-541  H-Bb L-Bb 
6fqv X-ray 2.6 B 430-541  H-Bb L-Bb 
6fqv X-ray 2.6 U 430-541  H-Bb L-Bb 
6fqv X-ray 2.6 S 430-541  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text