Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P68431
RecName: Histone H3.1
Begin-End: 39-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P68431 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xf4 X-ray 2.87 E 38-131 None
5xf4 X-ray 2.87 A 38-131 None
3azl X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azl X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
2cv5 X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
2cv5 X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av9 X-ray 2.2 E 37-131 None
5av9 X-ray 2.2 A 37-131 None
3azg X-ray 2.4 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azg X-ray 2.4 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w98 X-ray 3.42 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w98 X-ray 3.42 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3waa X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3waa X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3afa X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3afa X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azi X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azi X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azf X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azf X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3aze X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3aze X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azj X-ray 2.89 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azj X-ray 2.89 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azk X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azk X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azm X-ray 2.89 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azm X-ray 2.89 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3ayw X-ray 2.9 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3ayw X-ray 2.9 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azn X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azn X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azh X-ray 3.49 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azh X-ray 3.49 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wa9 X-ray 3.07 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wa9 X-ray 3.07 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w96 X-ray 3 E 38-131  H-Bb H-Mj L-Bb 
3w96 X-ray 3 A 39-131  H-Bb H-Mj 
3w97 X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb 
3w97 X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5xf3 X-ray 2.6 A 38-131 None
5xf3 X-ray 2.6 E 38-131 None
5av6 X-ray 2.2 E 37-131 None
5av6 X-ray 2.2 A 37-131 None
5cpi X-ray 2.9 E 38-131  H-Bb S-Bb L-Bb 
5cpi X-ray 2.9 A 38-131  S-Bb L-Bb 
3wkj X-ray 2.8 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wkj X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1u X-ray 3.25 E 37-131  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 A 38-131  H-Bb H-Mj L-Bb 
3x1t X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1t X-ray 2.81 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1s X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1s X-ray 2.81 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5cpk X-ray 2.63 E 38-131  H-Bb S-Bb L-Bb L-Mn 
5cpk X-ray 2.63 A 38-131  H-Bb L-Bb 
5gt3 X-ray 2.91 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gt3 X-ray 2.91 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ym6 X-ray 3.51 E 37-131  H-Bb H-Mj S-Bb L-Bb 
4ym6 X-ray 3.51 A 38-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5b2j X-ray 2.6 E 37-131 None
5b2j X-ray 2.6 A 37-131 None
4ym5 X-ray 4.01 E 38-131  H-Bb H-Mj S-Bb L-Bb 
4ym5 X-ray 4.01 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av8 X-ray 2.2 E 37-131 None
5av8 X-ray 2.2 A 37-131 None
5gtc X-ray 2.7 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gtc X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b24 X-ray 3.6 E 37-131  H-Bb H-Mj S-Bb L-Bb 
5b24 X-ray 3.6 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gt0 X-ray 2.82 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gt0 X-ray 2.82 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av5 X-ray 2.4 E 37-131 None
5av5 X-ray 2.4 A 37-131 None
5gsu X-ray 3.1 E 37-131  H-Bb H-Mj S-Bb L-Bb 
5gsu X-ray 3.1 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b2i X-ray 3 E 37-131 None
5b2i X-ray 3 A 37-131 None
5gse X-ray 3.14 O 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gse X-ray 3.14 E 38-131  H-Bb H-Mj S-Bb L-Bb 
5gse X-ray 3.14 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5cpj X-ray 3.15 E 38-131  H-Bb H-Mj 
5cpj X-ray 3.15 A 41-131 None
5avb X-ray 2.4 A 37-131 None
5avb X-ray 2.4 E 37-131 None
6etx X-ray 4.8 M 37-131 None
6etx X-ray 4.8 I 40-131 None
5avc X-ray 2.4 E 37-131 None
5avc X-ray 2.4 A 37-131 None
5xf5 X-ray 2.82 E 38-131 None
5xf5 X-ray 2.82 A 38-131 None
3x1v X-ray 2.92 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1v X-ray 2.92 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b31 X-ray 2.2 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b31 X-ray 2.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w99 X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w99 X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text