Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P68431
RecName: Histone H3.1
Begin-End: 48-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFED
TNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P68431 48-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gse X-ray 3.14 K 47-131  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text