Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P68433
RecName: Histone H3.1
Begin-End: 39-132
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P68433 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1u35 X-ray 3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1u35 X-ray 3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b1m X-ray 2.34 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b1m X-ray 2.34 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b1l X-ray 2.35 E 38-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5b1l X-ray 2.35 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text