Pfam domain
Pfam family: Ribosomal_S21 (PF01165.19)
Uniprot AC: P68679
RecName: 30S ribosomal protein S21
Begin-End: 4-54
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVK
Structures of the domain P68679 4-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ykr X-ray 9.8 U 3-52 None
4a2i X-ray 16.5 U 3-52 None
4adv X-ray 13.5 U 3-52 None
5my1 X-ray 7.6 U 3-52 None


© NPIDB team 2003 - 2019

text