Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: P68742
RecName: Viral histone-like protein
Begin-End: 9-104
Organism: African swine fever virus
Interaction Mode:  S-Bb S-Mj 

Sequence:
ITKQELYSLVAADTQLNKALIERIFTSQQKIIQNALKHNQEVIIPPGIKFTVVTVKAKPA
RQGHNPATGEPIQIKAKPEHKAVKIRALKPVHDMLN
Structures of the domain P68742 9-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6lmj X-ray 2.8 B 15-110  S-Bb 
6lmj X-ray 2.8 A 15-110  S-Mj 


© NPIDB team 2003 - 2021

text