Pfam domain
Pfam family: Ribosomal_S27 (PF01599.18)
Uniprot AC: P69061
RecName: Ubiquitin-40S ribosomal protein S27a
Begin-End: 102-145
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
VLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHST
Structures of the domain P69061 102-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 f 102-145 None
3j80 X-ray 3.75 f 102-145 None
3jam X-ray 3.46 f 102-145 None
3jaq X-ray 6 f 102-145 None
3j81 X-ray 4 f 42-85 None
3jap X-ray 4.9 f 102-145 None


© NPIDB team 2003 - 2019

text