Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: P69222
RecName: Translation initiation factor IF-1
Begin-End: 7-70
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGR
IVFR
Structures of the domain P69222 7-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1zo1 X-ray 13.8 W 9-70 None


© NPIDB team 2003 - 2019

text