Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: P70326
RecName: T-box transcription factor TBX5
Begin-End: 56-238
Organism: Mus musculus
Interaction Mode:  H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
VFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYK
FADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNS
MHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKG
FRG
Structures of the domain P70326 56-238
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5flv X-ray 3 A 1057-1237  S-Bb S-Mj L-Bb L-Mj L-Mn 
5flv X-ray 3 E 1057-1237  H-Mn S-Bb L-Bb L-Mj 
5flv X-ray 3 I 1057-1237  H-Mn S-Bb S-Mj L-Bb L-Mj 
5flv X-ray 3 M 1057-1237  H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text