Pfam domain
Pfam family: MH1 (PF03165.15)
Uniprot AC: P70340
RecName: Mothers against decapentaplegic homolog 1
Begin-End: 30-131
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
AEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYC
RVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVE
Structures of the domain P70340 30-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kmp X-ray 2.7 A 31-131  S-Bb S-Mj L-Bb L-Mj 
3kmp X-ray 2.7 B 31-131  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text