Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P70696
RecName: Histone H2B type 1-A
Begin-End: 35-103
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSR
EIQTAVRLL
Structures of the domain P70696 35-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3x1t X-ray 2.81 H 34-100  H-Bb S-Bb L-Bb 
3x1t X-ray 2.81 D 34-100  H-Bb H-Mj S-Bb L-Bb 
3x1v X-ray 2.92 H 33-100  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text