Pfam domain
Pfam family: PemK_toxin (PF02452.16)
Uniprot AC: P71650
RecName: Endoribonuclease MazF9
Begin-End: 3-114
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
RRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQ
VLLSATTTGLQVDCKAQAEQIRSIATERLLRPIGRVSAAELAQLDEALKLHL
Structures of the domain P71650 3-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hjz X-ray 1.98 A 3-113 None
5hjz X-ray 1.98 B 3-113 None


© NPIDB team 2003 - 2019

text