Pfam domain
Pfam family: Trans_reg_C (PF00486.27)
Uniprot AC: P71814
RecName: Possible two component system response transcriptional positive regulator PhoP
Begin-End: 169-243
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
GQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTG
EKRLLHTLRGVGYVL
Structures of the domain P71814 169-243
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ed4 X-ray 2.4 A 169-243  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ed4 X-ray 2.4 B 169-243  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ed4 X-ray 2.4 E 169-243  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ed4 X-ray 2.4 F 169-243  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text