Pfam domain
Pfam family: Response_reg (PF00072.23)
Uniprot AC: P71814
RecName: Possible two component system response transcriptional positive regulator PhoP
Begin-End: 23-133
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
VLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRARETRPDAVILDVMMPGMDGFGV
LRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLR
Structures of the domain P71814 23-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ed4 X-ray 2.4 B 23-132 None
5ed4 X-ray 2.4 A 23-132 None
5ed4 X-ray 2.4 F 23-132 None
5ed4 X-ray 2.4 E 23-132 None


© NPIDB team 2003 - 2019

text