Pfam domain
Pfam family: CRISPR_Cse2 (PF09485.9)
Uniprot AC: P76632
RecName: CRISPR system Cascade subunit CasB
Begin-End: 21-152
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKKSE
QTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWW
GKRERQQLLEDF
Structures of the domain P76632 21-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qyz X-ray 3.03 C 23-150 None
4qyz X-ray 3.03 B 23-150 None
4u7u X-ray 3 O 23-150 None
4u7u X-ray 3 N 23-150 None
4u7u X-ray 3 N 23-150 None
4u7u X-ray 3 O 23-150 None
4u7u X-ray 3 B 23-150 None
4u7u X-ray 3 C 23-150 None
4u7u X-ray 3 C 23-150 None
4u7u X-ray 3 B 23-150 None
5cd4 X-ray 3.2 K 23-150 None
5cd4 X-ray 3.2 J 23-150 None
5cd4 X-ray 3.2 W 23-150 None
5cd4 X-ray 3.2 V 23-150 None
5h9e X-ray 3.21 B 23-150 None
5h9e X-ray 3.21 C 23-150 None
5h9f X-ray 2.45 B 23-150 None
5h9f X-ray 2.45 C 23-150 None


© NPIDB team 2003 - 2019

text