Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P77933
RecName: DNA polymerase
Begin-End: 126-278
Organism: Thermococcus kodakarensis
Interaction Mode:  L-Bb 

Sequence:
LVPMEGDEELKMLAFDIETLYHEGEEFAEGPILMISYADEEGARVITWKNVDLPYVDVVS
TEREMIKRFLRVVKEKDPDVLITYNGDNFDFAYLKKRCEKLGINFALGRDGSEPKIQRMG
DRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAV
Structures of the domain P77933 126-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omf X-ray 2.09 A 130-278 None
4k8z X-ray 2.29 A 130-278  L-Bb 


© NPIDB team 2003 - 2020

text