Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P80373
RecName: 30S ribosomal protein S4
Begin-End: 49-98
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLE
Structures of the domain P80373 49-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1fka X-ray 3.3 D 50-98 None


© NPIDB team 2003 - 2019

text