Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P81288
RecName: 30S ribosomal protein S4
Begin-End: 43-91
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
KLSEYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLE
Structures of the domain P81288 43-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 A 2-50 None


© NPIDB team 2003 - 2019

text