Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P82139
RecName: 50S ribosomal protein L10, chloroplastic
Begin-End: 54-152
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
ISRTKKEETVETVQKHLENCYLLAAINYKGFTVKQFQDLRKALPENTTLIVAKNTLVEKA
VQDTQWAAIKPCMKGMNAWLFVHSEEIPIAIKPYRTFQK
Structures of the domain P82139 54-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mmi X-ray 3.25 I 56-140 None


© NPIDB team 2003 - 2019

text