Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: P82190
RecName: 50S ribosomal protein L27, chloroplastic
Begin-End: 66-137
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
TKNGRDSKGQRLGVKIYGDQVAKPGAIIIRQRGTKFHPGKNVGIGKDHTIFALIDGLVKF
EKYGPDKKKVSV
Structures of the domain P82190 66-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 X 66-137 None
5h1s X-ray 3.5 X 66-137 None
5mmi X-ray 3.25 X 66-137 None


© NPIDB team 2003 - 2019

text