Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P82191
RecName: 50S ribosomal protein L3, chloroplastic
Begin-End: 173-275
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
LVSVDDFTPSQKLLFEELFKEGDMVDISGTTIGKGFQGGIKRHNFKRGLMTHGSKSHRAL
GSIGAGTTPGHVYKGKKMPGRMGGTKTKIRKLKIMKIDTDLRV
Structures of the domain P82191 173-275
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 D 184-271 None
5h1s X-ray 3.5 F 184-271 None
5mlc X-ray 3.9 E 184-271 None
5mmi X-ray 3.25 D 184-271 None


© NPIDB team 2003 - 2019

text