Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: P82192
RecName: 50S ribosomal protein L5, chloroplastic
Begin-End: 77-133
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
NILEVPKVVKIVVNCGIGDASQNAKGLDAAINELALITGQRPVKTKAKTSIAGFKVR
Structures of the domain P82192 77-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 F 77-133 None
5h1s X-ray 3.5 H 69-133 None
5mlc X-ray 3.9 G 39-95 None
5mmi X-ray 3.25 F 77-133 None


© NPIDB team 2003 - 2019

text