Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P82193
RecName: 50S ribosomal protein L6, chloroplastic
Begin-End: 50-122
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
VPANVAIAMEGQDLKVKGPLGELSITYPREVLVEKQESGFLRVRKAVETRRANQMHGLFR
TLTDNMVVGVSKG
Structures of the domain P82193 50-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 G 50-122 None
5h1s X-ray 3.5 I 50-122 None
5mlc X-ray 3.9 H 50-122 None
5mmi X-ray 3.25 G 50-122 None


© NPIDB team 2003 - 2019

text