Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: P82194
RecName: 50S ribosomal protein L17, chloroplastic
Begin-End: 30-126
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
LLRGLTTQLLKHGRIKTTRAKASAMRKYVDKMITLAKEGSLHKRRQALGFIYEKQIVHAL
FAEVPERYGDRNGGYTRIIRTLPRRGDNAPMAYIELV
Structures of the domain P82194 30-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 O 30-126 None
5h1s X-ray 3.5 P 30-126 None
5mlc X-ray 3.9 P 30-126 None
5mmi X-ray 3.25 O 30-126 None


© NPIDB team 2003 - 2019

text