Pfam domain
Pfam family: RRF (PF01765.18)
Uniprot AC: P82231
RecName: Ribosome-recycling factor, chloroplastic
Begin-End: 106-269
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
IRSNFNSVRTNRASPTMLDRIEVEYYGTPVSLKSIAQISTPDASSLLISPYDKSSLKAIE
KAIVTSQLGVSPNNDGEVIRLSLPPLTSDRRKELAKVVSKLAEEGKVAVRNIRRDALKSY
EKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQKEQELM
Structures of the domain P82231 106-269
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mlc X-ray 3.9 9 104-269 None


© NPIDB team 2003 - 2019

text