Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: P82245
RecName: 50S ribosomal protein L28, chloroplastic
Begin-End: 73-132
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
RICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKN
Structures of the domain P82245 73-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 Y 73-131 None
5h1s X-ray 3.5 Y 73-131 None
5mlc X-ray 3.9 Y 73-131 None
5mmi X-ray 3.25 Y 73-131 None


© NPIDB team 2003 - 2019

text