Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: P82278
RecName: 30S ribosomal protein S9, chloroplastic
Begin-End: 87-208
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
GRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVFVKAH
GGGLSGQAQAISLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFS
KR
Structures of the domain P82278 87-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mmj X-ray 3.65 i 87-208 None
5x8r X-ray 3.7 i 76-195 None


© NPIDB team 2003 - 2019

text