Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: P82403
RecName: 30S ribosomal protein S6 alpha, chloroplastic
Begin-End: 107-205
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
QYETMAVLRPDMTEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGETN
NYLDGIYLLFTYFTKPESISPLEAALVTDDDVIRSSSFK
Structures of the domain P82403 107-205
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5mmj X-ray 3.65 f 107-205 None
5x8r X-ray 3.7 f 107-205 None


© NPIDB team 2003 - 2019

text