Pfam domain
Pfam family: DUF5323 (PF17257.1)
Uniprot AC: P82411
RecName: 50S ribosomal protein 6, chloroplastic
Begin-End: 48-93
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVS
Structures of the domain P82411 48-93
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 7 48-93 None
5h1s X-ray 3.5 h 48-93 None
5mlc X-ray 3.9 8 48-94 None
5mmi X-ray 3.25 7 48-93 None


© NPIDB team 2003 - 2019

text