Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: P82413
RecName: 50S ribosomal protein L19, chloroplastic
Begin-End: 126-232
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
LNKKAVHAAEELRPVPGIRTGDIVQIRLEVPENKRRLSVYKGIVISRQNAGIHTTIRIRR
IIAGVGVEIVFPLYSPNIKEIKVVSHRKVRKARLYYLRDKLPRLSTF
Structures of the domain P82413 126-232
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 Q 137-225 None
5h1s X-ray 3.5 R 137-225 None
5mlc X-ray 3.9 R 137-225 None
5mmi X-ray 3.25 Q 137-226 None


© NPIDB team 2003 - 2019

text