Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: P82931
RecName: 28S ribosomal protein S6, mitochondrial
Begin-End: 3-95
Organism: Bos taurus
Interaction Mode:   

Sequence:
RYELALILKAMQRPETAAALKRTLEALMDRGAVVRSLENLGERTLPYKMSAHSQRHTRGG
YFLVDFYAPTTTVASIMEHLSRDIDVIRPNVVK
Structures of the domain P82931 3-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jd5 X-ray 7 F 3-95 None


© NPIDB team 2003 - 2019

text