Pfam domain
Pfam family: HHH (PF00633.22)
Uniprot AC: P83847
RecName: Adenine DNA glycosylase
Begin-End: 105-134
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
RYGGKVPDDPDEFSRLKGVGPYTVGAVLSL
Structures of the domain P83847 105-134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rrs X-ray 2.4 A 105-133 None
1rrq X-ray 2.22 A 105-133 None
1vrl X-ray 2.5 A 105-133 None
5dpk X-ray 2.2 A 105-133 None
5kn9 X-ray 1.93 A 105-133 None
5kn8 X-ray 1.81 A 105-133 None
4ypr X-ray 2.59 B 105-133 None
4ypr X-ray 2.59 A 105-133 None
4yph X-ray 2.32 A 105-133 None
4yoq X-ray 2.21 A 105-133 None
3g0q X-ray 2.2 A 105-133 None
3fsp X-ray 2.2 A 105-133 None


© NPIDB team 2003 - 2019

text